Skip to Content

ELISA Recombinant Pan troglodytes Natural cytotoxicity triggering receptor 3(NCR3)

https://www.casey-lab.com/web/image/product.template/148795/image_1920?unique=45d657d
Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Pan troglodytes (Chimpanzee) Uniprot NO.:P61484 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:LWVSQPPEIRTLEGSSAFLPCSFNASQGRLAIGSVTWFRDEVVPGKEVRNETPEFRGRLAPLASSRFLHDHQAELHIRDVRGHDASIYVCRVEVLGLGVGTGNGTRLVVEKEHPQLGAGTVLLLRAGFYAVSFLSVAVGSTVYYQGKCLTWKGPRRQLPAVVPAPLPPPCGSSAQLLPPVPGG Protein Names:Recommended name: Natural cytotoxicity triggering receptor 3 Alternative name(s): Natural killer cell p30-related protein Short name= NK-p30 Short name= NKp30 CD_antigen= CD337 Gene Names:Name:NCR3 Expression Region:19-201 Sequence Info:fµLl length protein

1,528.00 € 1528.0 EUR 1,528.00 €

1,528.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days